PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G29020.1
Common NameAtMYB110, MYB110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 233aa    MW: 27613.5 Da    PI: 10.2838
Description myb domain protein 110
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G29020.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.12.7e-1565110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W   Ed +l ++v  +G+ +W+ Ia+ m+ gRt+k+c++rw++ 
      AT3G29020.1  65 RGHWRISEDTQLMELVSVYGPQNWNHIAESMQ-GRTGKSCRLRWFNQ 110
                      789999**************************.***********996 PP

2Myb_DNA-binding51.81.9e-16118161247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +++ eE+e+l+ a++ +G++ W+ Ia+ ++ gRt++ +k++w+ +
      AT3G29020.1 118 RAFSDEEEERLLAAHRAFGNK-WAMIAKLFN-GRTDNALKNHWHVL 161
                      689******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.13860111IPR017930Myb domain
SMARTSM007171.2E-1064113IPR001005SANT/Myb domain
PfamPF002497.9E-1565110IPR001005SANT/Myb domain
SuperFamilySSF466893.15E-2765158IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-2466118IPR009057Homeodomain-like
CDDcd001671.21E-968109No hitNo description
PROSITE profilePS5129425.414112166IPR017930Myb domain
SMARTSM007171.8E-13116164IPR001005SANT/Myb domain
PfamPF002498.6E-13118161IPR001005SANT/Myb domain
CDDcd001672.69E-9119162No hitNo description
Gene3DG3DSA:1.10.10.601.9E-20119166IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MDFSCFQEYP FEFHCRGTTF NGFRENNAVS ETVEEFCNKR RMQKKSDDLK TKKKKKQSVS  60
RVCSRGHWRI SEDTQLMELV SVYGPQNWNH IAESMQGRTG KSCRLRWFNQ LDPRINKRAF  120
SDEEEERLLA AHRAFGNKWA MIAKLFNGRT DNALKNHWHV LMARKMRQQS SSYVQRFNGS  180
AHESNTDHKI FNLSPGLSLL TLHICIEFNS VIVMRYFRYL SLRNNELMVW SQK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-32651664105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13852KRRMQKKSDDLKTKK
23855KRRMQKKSDDLKTKKKKK
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible258004_at0.0
Expression AtlasAT3G29020-
AtGenExpressAT3G29020-
ATTED-IIAT3G29020-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB110).
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G29020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G29020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2727320.0AF272732.1 Arabidopsis thaliana putative transcription factor (MYB110) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_566841.11e-177myb domain protein 110
TrEMBLQ9FYX61e-177Q9FYX6_ARATH; Myb domain protein 110
STRINGAT3G29020.21e-147(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Osuna D, et al.
    Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings.
    Plant J., 2007. 49(3): p. 463-91
    [PMID:17217462]
  4. Johnston AJ, et al.
    Genetic subtraction profiling identifies genes essential for Arabidopsis reproduction and reveals interaction between the female gametophyte and the maternal sporophyte.
    Genome Biol., 2007. 8(10): p. R204
    [PMID:17915010]